PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_6285g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 370aa    MW: 41758.5 Da    PI: 5.1789
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_6285g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++lv++++  G g+W++ ++  g+ R++k+c++rw +yl
     MA_6285g0010 14 KGTWSPEEDKILVNYIENNGHGSWRALPKLAGLLRCGKSCRLRWSNYL 61
                     799*****************************99************97 PP

2Myb_DNA-binding46.96.2e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eE+  ++++++ lG++ W+ Ia+ ++ +Rt++++k++w++ 
     MA_6285g0010  67 RGSFTREEERTIIQLHAILGNR-WSIIASQLP-RRTDNEIKNFWNTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.181961IPR017930Myb domain
SuperFamilySSF466898.24E-2811108IPR009057Homeodomain-like
SMARTSM007171.2E-111363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
CDDcd001672.00E-81661No hitNo description
PROSITE profilePS5129425.33462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2465116IPR009057Homeodomain-like
SMARTSM007178.9E-1666114IPR001005SANT/Myb domain
PfamPF002497.7E-1467112IPR001005SANT/Myb domain
CDDcd001679.59E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRAPCYEKT GLKKGTWSPE EDKILVNYIE NNGHGSWRAL PKLAGLLRCG KSCRLRWSNY  60
LRPDIKRGSF TREEERTIIQ LHAILGNRWS IIASQLPRRT DNEIKNFWNT NLKKRLLKMG  120
LDPSTHAPKE EAKPTAPHGY EALALTRHKT QWENARLEAE ARLSRESLIM SFDSATPIKS  180
TVEIITIPND NPPADYFLKL WNSEIGKAFR NENHHPNGGN DPVFSSEVPL SSVSNMCCAS  240
TQHSCDQSLN PNDEDKDNGS QQCNSSSFEW IGDCNVKTPE ELSCFPGMAL GQTEDKVAEE  300
LGPAQIVHYI GFPELLLDFP DNDDKNNNTN SFQSELSTAF QQQSASPWPE LHDEEYWSNM  360
SFIDQASADT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051856.12e-92Myb domain protein 17 isoform 1
RefseqXP_010255443.11e-92PREDICTED: transcription factor MYB3-like
TrEMBLA0A061E1592e-92A0A061E159_THECC; Myb domain protein 17 isoform 1
TrEMBLA0A0K9PNG53e-92A0A0K9PNG5_Z
STRINGVIT_15s0046g03190.t014e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-91myb domain protein 17